Metadata-Version: 1.1
Name: mhctools
Version: 0.2.2
Summary: Python interface to running command-line and web-based MHC binding predictors
Home-page: https://github.com/hammerlab/mhctools
Author: Alex Rubinsteyn
Author-email: alex {dot} rubinsteyn {at} mssm {dot} edu
License: http://www.apache.org/licenses/LICENSE-2.0.html
Description: `|Build Status| <https://travis-ci.org/hammerlab/mhctools>`_ `|Coverage
        Status| <https://coveralls.io/r/hammerlab/mhctools?branch=master>`_
        `|DOI| <https://zenodo.org/badge/latestdoi/18834/hammerlab/mhctools>`_
        
        mhctools
        ========
        
        Python interface to running command-line and web-based MHC binding
        predictors.
        
        Example
        -------
        
        \`\`\`python from mhctools import NetMHCpan # Run NetMHCpan for alleles
        HLA-A*01:01 and HLA-A*02:01 predictor = NetMHCpan(alleles=["A\*02:01",
        "hla-a0101"])
        
        scan the short proteins 1L2Y and 1L3Y for epitopes
        ==================================================
        
        protein\_sequences = { "1L2Y": "NLYIQWLKDGGPSSGRPPPS", "1L3Y":
        "ECDTINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQA" }
        
        epitope\_collection = predictor.predict(protein\_sequences)
        
        flatten binding predictions into a Pandas DataFrame
        ===================================================
        
        df = epitope\_collection.dataframe()
        
        epitope collection is sorted by percentile rank
        ===============================================
        
        of binding predictions
        ======================
        
        strongest\_predicted\_binder = epitope\_collection[0] \`\`\` ## API
        
        The following models are available in ``mhctools``: \* ``NetMHC3``:
        requires locally installed version of `NetMHC
        3.x <http://www.cbs.dtu.dk/services/NetMHC-3.4/>`_ \* ``NetMHC4``:
        requires locally installed version of `NetMHC
        4.x <http://www.cbs.dtu.dk/services/NetMHC/>`_ \* ``NetMHC``: a wrapper
        function to automatically use ``NetMHC3`` or ``NetMHC4`` depending on
        what's installed. \* ``NetMHCpan``: requires locally installed version
        of `NetMHCpan <http://www.cbs.dtu.dk/services/NetMHCpan/>`_ \*
        ``NetMHCIIpan``: requires locally installed version of
        `NetMHCIIpan <http://www.cbs.dtu.dk/services/NetMHCIIpan/>`_ \*
        ``NetMHCcons``: requires locally installed version of
        `NetMHCcons <http://www.cbs.dtu.dk/services/NetMHCcons/>`_ \*
        ``IedbMhcClass1``: Uses IEDB's REST API for class I binding predictions.
        \* ``IedbMhcClass2``: Uses IEDB's REST API for class II binding
        predictions. \* ``RandomBindingPredictor``: Creates binding predictions
        with random IC50 and percentile rank values.
        
        Every model is constructed with an ``alleles`` argument specifying the
        HLA type for which to make predictions. Predictions are generated by
        calling the ``predict`` method with a dictionary mapping sequence IDs or
        names to amino acid sequences.
        
        .. |Build
        Status| image:: https://travis-ci.org/hammerlab/mhctools.svg?branch=master
        .. |Coverage
        Status| image:: https://coveralls.io/repos/hammerlab/mhctools/badge.svg?branch=master
        .. |DOI| image:: https://zenodo.org/badge/18834/hammerlab/mhctools.svg
        
Platform: UNKNOWN
Classifier: Development Status :: 3 - Alpha
Classifier: Environment :: Console
Classifier: Operating System :: OS Independent
Classifier: Intended Audience :: Science/Research
Classifier: License :: OSI Approved :: Apache Software License
Classifier: Programming Language :: Python
Classifier: Topic :: Scientific/Engineering :: Bio-Informatics
