Metadata-Version: 2.1
Name: iedb
Version: 0.0.2
Summary: Python SDK for IEDB Tools API. Full details can be found at     http://tools.iedb.org/main/tools-api/
Home-page: http://packages.python.org/iedb
Author: Matt Femia
License: MIT
Description: 
        # IEDB API Tools Python SDK  
        
        [![PyPI version fury.io](https://badge.fury.io/py/iedb.svg)](https://pypi.python.org/pypi/iedb/)
        [![Build Status](https://www.travis-ci.com/mattfemia/iedb-python.svg?branch=master)](https://www.travis-ci.com/mattfemia/iedb-python)
        [![codecov](https://codecov.io/gh/mattfemia/iedb-python/branch/master/graph/badge.svg?token=WKDI6ZLK0I)](https://codecov.io/gh/mattfemia/iedb-python)
          
        ### Python SDK for Immune Epitope Database (IEDB) Analysis Tools API. Includes support for the following prediction tools:  
          
        - MHC-I peptide binding:  
          - Determine sequence's ability to bind to MHC class I molecule  
        - MHC-II peptide binding:  
          - Determine sequence's ability to bind to MHC class II molecule  
        - T-cell epitope prediction:  
          - Use predictors to determine peptide's potential of being a T-cell epitope  
        - MHC-Natural Peptide:  
          - Assess probability that peptide is naturally processed by the MHC  
        - Antibody epitope prediction:  
          - Predict B-cell epitopes from protein sequence(s)
          
        View the [web application](http://tools.iedb.org/main/)  
          
        ## Installation  
          
        Run the following to install:
        ```python  
        pip install iedb
        ```  
        
        ## Usage  
          
        ```python
        import iedb
        
        # Send POST request to MHC class I peptide binding prediction tool:
        mhci_res = iedb.query_mhci_binding(method="recommended", sequence="ARFTGIKTA", allele="HLA-A*02:01", length=8)
        
        # Send POST request to MHC class II peptide binding prediction tool:
        mhcii_res = iedb.query_mhcii_binding(method="nn_align", sequence="SLYNTVATLYCVHQRIDV", allele="HLA-DRB1*01:01", length=None)
        
        # Send POST request to T-cell epitope prediction tool:
        tcell_res = iedb.query_tcell_epitope(method="smm", sequence="SLYNTVATLYCVHQRIDV", allele="HLA-A*01:01", length=9, proteasome='immuno')
        
        # Send POST request to peptide prediction tool:
        pep_res = iedb.query_peptide_prediction(method="mhcnp", sequence="SLYNTVATLYCVHQRIDV", allele="HLA-A*02:01", length=9)
        
        # Send POST request to B-cell epitope prediction tool:
        bcell_res = iedb.query_bcell_epitope(method="Emini", sequence="VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTE", window_size=9)
        
        ```
Keywords: iedb mhc mhc-binding t-cell epitope mhc-i mhc-ii hla
Platform: UNKNOWN
Classifier: Development Status :: 3 - Alpha
Classifier: Topic :: Utilities
Classifier: Operating System :: OS Independent
Requires-Python: >=3.6
Description-Content-Type: text/markdown
