Metadata-Version: 1.1
Name: mhctools
Version: 0.1.3
Summary: Python interface to running command-line and web-based MHC binding predictors
Home-page: https://github.com/hammerlab/mhctools
Author: Alex Rubinsteyn
Author-email: alex {dot} rubinsteyn {at} mssm {dot} edu
License: http://www.apache.org/licenses/LICENSE-2.0.html
Description: mhctools
        ========
        
        Python interface to running command-line and web-based MHC binding
        predictors.
        
        Example
        -------
        
        .. code:: python
        
            from mhctools import NetMHCpan
            # Run NetMHCpan for alleles HLA-A*01:01 and HLA-A*02:01
            predictor = NetMHCpan(alleles=["A*02:01", "hla-a0101"])
        
            # scan the short proteins 1L2Y and 1L3Y for epitopes
            protein_sequences = {
              "1L2Y": "NLYIQWLKDGGPSSGRPPPS",
              "1L3Y": "ECDTINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQA"
            }
        
            epitope_collection = predictor.predict(protein_sequences)
        
            # flatten binding predictions into a Pandas DataFrame
            df = epitope_collection.dataframe()
        
            # epitope collection is sorted by percentile rank
            # of binding predictions
            strongest_predicted_binder = epitope_collection[0]
        
        API
        ---
        
        The following models are available in ``mhctools``: \* ``NetMHCpan``:
        requires locally installed version of
        `NetMHCpan <http://www.cbs.dtu.dk/services/NetMHCpan/>`__ \*
        ``NetMHCcons``: requires locally installed version of
        `NetMHCcons <http://www.cbs.dtu.dk/services/NetMHCcons/>`__ \*
        ``IedbMhcClass1``: Uses IEDB's REST API for class I binding predictions.
        \* ``IedbMhcClass2``: Uses IEDB's REST API for class II binding
        predictions. \* ``RandomBindingPredictor``: Creates binding predictions
        with random IC50 and percentile rank values.
        
        Every model is constructed with an ``alleles`` argument specifying the
        HLA type for which to make predictions. Predictions are generated by
        calling the ``predict`` method with a dictionary mapping sequence IDs or
        names to amino acid sequences.
        
Platform: UNKNOWN
Classifier: Development Status :: 3 - Alpha
Classifier: Environment :: Console
Classifier: Operating System :: OS Independent
Classifier: Intended Audience :: Science/Research
Classifier: License :: OSI Approved :: Apache Software License
Classifier: Programming Language :: Python
Classifier: Topic :: Scientific/Engineering :: Bio-Informatics
